Scaffold Ga0103747_10146374

Overview

Basic Information

• Taxon OID: 3300009295
• Scaffold ID: Ga0103747_10146374
• Source Dataset Name: Microbial communities of wastewater sludge from Singapore - Sludge5_b2_February
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 625
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge → Microbial Communities Of Wastewater Sludge From Singapore

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.2
  • Long. (^o): 103.45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010686	Metagenome / Metatranscriptome	300	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103747_101463742	F010686	AGGA	VDQCGQATKGVWGMSWRQEAMKGVEDCDKPGELVKRELIPGYPNKRMLNP*