| Basic Information | |
|---|---|
| Taxon OID | 3300009292 Open in IMG/M |
| Scaffold ID | Ga0123226_10024 Open in IMG/M |
| Source Dataset Name | Estuarine microbial communities from Mobile Bay, Alabama - Sample Wi re-assembly with CLC |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Auburn University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 542 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From Mobile Bay, Alabama |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mobile Bay, Alabama | |||||||
| Coordinates | Lat. (o) | 30.4464641 | Long. (o) | -87.9922684 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010726 | Metagenome / Metatranscriptome | 300 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0123226_100242 | F010726 | N/A | MKLVFALIVLIDGTVDAEATSYWHDITRCRWFAEELTIQGTIRRYDTPVHAYCKPVYVDPAE |
| ⦗Top⦘ |