Scaffold Ga0103680_10469745

Overview

Basic Information

• Taxon OID: 3300009285
• Scaffold ID: Ga0103680_10469745
• Source Dataset Name: Microbial communities from groundwater in Rifle, Colorado, USA - 2A_0.1um
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Lawrence Berkeley National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 655
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater → Microbial Communities From Groundwater In Rifle, Colorado, Usa

Source Dataset Sampling Location

• Location Name: Rifle, CO, USA
• Coordinates
  • Lat. (^o): 39.32
  • Long. (^o): -107.46

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094884	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103680_104697451	F094884	N/A	RLKMKDKLIGQVYINIIKDEKGEIKFAYGYEMKEEELSLNDFAMLNSFLDKLKTKAKEDFEERLEVNDKEFSIEKE*