Basic Information | |
---|---|
Taxon OID | 3300009285 Open in IMG/M |
Scaffold ID | Ga0103680_10259067 Open in IMG/M |
Source Dataset Name | Microbial communities from groundwater in Rifle, Colorado, USA - 2A_0.1um |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Lawrence Berkeley National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 919 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater → Microbial Communities From Groundwater In Rifle, Colorado, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rifle, CO, USA | |||||||
Coordinates | Lat. (o) | 39.32 | Long. (o) | -107.46 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F060838 | Metagenome / Metatranscriptome | 132 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103680_102590672 | F060838 | GGAGG | MITFQYVQPTDEQKEVMQKFRAKYEILYKEVQELGVGRGLSLALTNLEQSAMWLNKSITKND* |
⦗Top⦘ |