Scaffold Ga0103879_10000204

Overview

Basic Information

• Taxon OID: 3300009276
• Scaffold ID: Ga0103879_10000204
• Source Dataset Name: Eukaryotic communities of water from the North Atlantic ocean - ACM57
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Georgia
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1384
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054549	Metatranscriptome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103879_100002041	F054549	N/A	FKEWITKASQGKEEEKKQLYGHLALSFGDVDVDKDGWIDAEEFDLLLEKVASLPRRFGLAPSAEVEYGGSIEKRKAARKAMFDAIDGSGGFKPRGKIAMGQFINWTNDHVIGKVASMEGETGRVAFRHVEDFTKEEYVSYVDEAVNDPKSIASTTLYNYLLTLFVEADKDCKGQISFEQFDTLVDIAAASPRHFGLAPQTRDAAARKEMFDAMDSTKTGFVTFRKFLRFVREHAKEKVAEYKK*