| Basic Information | |
|---|---|
| Taxon OID | 3300009269 Open in IMG/M |
| Scaffold ID | Ga0103876_1026878 Open in IMG/M |
| Source Dataset Name | Eukaryotic communities of water from the North Atlantic ocean - ACM28 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Georgia |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 726 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000446 | Metatranscriptome | 1128 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103876_10268781 | F000446 | N/A | SSGIYLENCKYVNYGFFGNLEVISHQGFSTFLANLEDCVSALNWKGREKATGMEAWGEDLFMQRCMDLHGVDKVEAFDLTTDSMCKAFRPKGEKKNAKWRPNCALTSTAAMHPFMKPFDYFECLKATQR* |
| ⦗Top⦘ |