NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103874_1016013

Scaffold Ga0103874_1016013


Overview

Basic Information
Taxon OID3300009268 Open in IMG/M
Scaffold IDGa0103874_1016013 Open in IMG/M
Source Dataset NameEukaryotic communities of water from the North Atlantic ocean - ACM43
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Georgia
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)647
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location
Location NameNorth Pacific Ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001926Metagenome / Metatranscriptome616Y

Sequences

Protein IDFamilyRBSSequence
Ga0103874_10160132F001926N/AVRHEDIPETNNPKIRFPVLEGDKLMKEVLNGGYNVQAVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.