NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103856_10104475

Scaffold Ga0103856_10104475


Overview

Basic Information
Taxon OID3300009233 Open in IMG/M
Scaffold IDGa0103856_10104475 Open in IMG/M
Source Dataset NameMicrobial communities of water from Amazon river, Brazil - RCM9
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Georgia
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)540
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location
Location NameAmazon river
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091426Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0103856_101044751F091426AGAAGVRNLVRKTNKILSEAEYYTGVQTGTQSPETLSAYEYSRDNAPVLSKLSNLADQSPGGVNPQALPFPMQDAVLQLGNLYLQTLDLKNKAATAATLPLFKGKEADLKKFRAKLKGIMNAYKELAAELDKFTLAPK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.