Scaffold Ga0103850_1000437

Overview

Basic Information

• Taxon OID: 3300009223
• Scaffold ID: Ga0103850_1000437
• Source Dataset Name: Microbial communities of water from Amazon river, Brazil - RCM3
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Georgia
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3331
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon river
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083937	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103850_10004373	F083937	GAG	MGKTYKKHSNDEEFSSQRSGKHAKHANGKKTGGMKTLNSYVEEDYDEDPFHDEVDGIHDEIFITHTKNTK*