Scaffold Ga0103849_1010145

Overview

Basic Information

• Taxon OID: 3300009221
• Scaffold ID: Ga0103849_1010145
• Source Dataset Name: Microbial communities of water from Amazon river, Brazil - RCM2
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Georgia
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1108
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon river
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076149	Metagenome / Metatranscriptome	118	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103849_10101452	F076149	N/A	MNKLLLTTLGMVAAVSAAYAQGTFNANNNFTPAGASAKAFVLGLDGNPLAKANGRVEILSGGTTLSPNGSAGVALTLDGLFFINGLVAPNAGLGGTANLVVRAWDVTSGATYDAAKTRGSVNVVISSLGGGTTPPATFGNNSDFKGLKLEGGG