Scaffold Ga0103842_1042872

Overview

Basic Information

• Taxon OID: 3300009216
• Scaffold ID: Ga0103842_1042872
• Source Dataset Name: Microbial communities of water from the North Atlantic ocean - ACM47
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Georgia
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 544
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030978	Metatranscriptome	183	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103842_10428721	F030978	GGA	MEDEEQWIWKNGLVVRTKNQISNLTRKVEEFNGKICSIGGSSVISNGGYLKDMLDLNTELIGYLSSITDNVNVRDLFDFLTICYCEYDHFFKDHREEIIAHHQQRTVLLPLAYDIVFNEIKGILDFITNNTVNYTM*