NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103842_1028930

Scaffold Ga0103842_1028930


Overview

Basic Information
Taxon OID3300009216 Open in IMG/M
Scaffold IDGa0103842_1028930 Open in IMG/M
Source Dataset NameMicrobial communities of water from the North Atlantic ocean - ACM47
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Georgia
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)611
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location
Location NameNorth Pacific Ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035617Metatranscriptome171N

Sequences

Protein IDFamilyRBSSequence
Ga0103842_10289301F035617N/AEMIDVKGTGYITLNQWIRFAIDHILKKYVQLPKDYLSGSAADVTKEEFLAFIKKAVDTNSMEYKELYYFLLRTFQAGDKGGYGEVEPAEFDEMIECAAAAPRRFGLAPKSSEMFKSEQARLINRMTLFSQMDTTSTGKITFDGWLAFAMEHIMGKVRTL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.