| Basic Information | |
|---|---|
| Taxon OID | 3300009208 Open in IMG/M |
| Scaffold ID | Ga0103760_1016668 Open in IMG/M |
| Source Dataset Name | Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample 1-1 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Duisburg-Essen |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 796 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Chrysophyceae → Chromulinales → Chromulinaceae → Spumella → Spumella elongata | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Eutrophic Pond → Planktonic Communities From Eutrophic Pond At The Campus Essen Of The University Duisburg-essen, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University Duisburg-Essen, Germany | |||||||
| Coordinates | Lat. (o) | 51.46 | Long. (o) | 7.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000631 | Metagenome / Metatranscriptome | 971 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103760_10166681 | F000631 | AGCAGG | LVAFLALISAHGAEGSVLRARRAAQEPDTACGKGFENLVKGSQDYYATASVELWTHPYHTMDNATFGQEFQCWFASMCTTKCGGLPSQAAARKSELAKMCKSVEADWLKIWKMFSQEEVVWFKKSYPSSEVQGEQESTVFYKQAMETAKEVNKKELLCLTLFTIDDECVKWPYIRLGE* |
| ⦗Top⦘ |