Scaffold Ga0103748_10074586

Overview

Basic Information

• Taxon OID: 3300009199
• Scaffold ID: Ga0103748_10074586
• Source Dataset Name: Microbial communities of wastewater sludge from Singapore - Sludge7_b2_February
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 598
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena → unclassified Anabaena → Anabaena sp. CRKS33 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge → Microbial Communities Of Wastewater Sludge From Singapore

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.2
  • Long. (^o): 103.45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100051	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103748_100745862	F100051	AGGAGG	MLERLICAVFGHHYVVERVLNHGARKVGCTRCGKHWAMHDGTRSFVPWDGEFESLYAPGGILAEASGDVTPNA*