Basic Information | |
---|---|
Taxon OID | 3300009193 Open in IMG/M |
Scaffold ID | Ga0115551_1022087 Open in IMG/M |
Source Dataset Name | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3320 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (14.29%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Germany:Helgoland, sampling site Kabeltonne, North Sea | |||||||
Coordinates | Lat. (o) | 54.1883 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015265 | Metagenome / Metatranscriptome | 256 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115551_10220871 | F015265 | N/A | ILIEKNAIVNLNNVGLPVFRNPTKDIMPITRPTKNPTRFNIFSNKNSNDV* |
⦗Top⦘ |