Scaffold Ga0114979_10140082

Overview

Basic Information

• Taxon OID: 3300009180
• Scaffold ID: Ga0114979_10140082
• Source Dataset Name: Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1484
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Simoncouche, Canada
• Coordinates
  • Lat. (^o): 48.2311
  • Long. (^o): -71.2508
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072349	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114979_101400827	F072349	AGGAGG	MDKVMCYSCNKSKNELSAKKSALLPINLLLCKSCAENKLEPRWIVILAGRQYGSDHVKDHIAKKKYVGVDITASELLI*