Basic Information | |
---|---|
Taxon OID | 3300009179 Open in IMG/M |
Scaffold ID | Ga0115028_10130947 Open in IMG/M |
Source Dataset Name | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1484 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Old Woman Creek National Estuarine Research Reserve, Ohio, USA | |||||||
Coordinates | Lat. (o) | 41.224 | Long. (o) | -82.304 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F070268 | Metagenome | 123 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115028_101309471 | F070268 | N/A | MEVVCLLSIIAVAALLVYSICRAPSRACHPIELRTLVFLSPSAAAPFEDLIAAGDVESVCRILKALEQRGELLVLETEKEIYIDCPEPCSREILPGVKTG* |
⦗Top⦘ |