Scaffold Ga0105248_10007688

Overview

Basic Information

• Taxon OID: 3300009177
• Scaffold ID: Ga0105248_10007688
• Source Dataset Name: Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11840
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (72.73%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: Michigan, USA
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032806	Metagenome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105248_100076889	F032806	N/A	VRFGVADSDWFSVLLISCICYLAPVPFGITLLYIPLQMWTWLLATAGAIAFFNYIRIGRKPYWLQHQLKALFSNHRQYRFIPNSRKSKFDRLWITDQQEDGRSPPKPSVTINSLLLQHNNSVREAWEENGTALGL*