Basic Information | |
---|---|
Taxon OID | 3300009175 Open in IMG/M |
Scaffold ID | Ga0073936_10380807 Open in IMG/M |
Source Dataset Name | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 873 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Finland: Lake Alinen Mustajarvi | |||||||
Coordinates | Lat. (o) | 61.5637 | Long. (o) | 22.044 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011059 | Metagenome | 295 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0073936_103808072 | F011059 | GAG | MTFEEWQSRYMNEEGSNYDREFRVQFISDYLLNPNLAATCRKHNVPYDTALAWKKKNWWYDISEDILQNHKEELLAKQRAILERTYDELGDRLINGDEQYVPNEGHVRVKVRANHLATIADTTLKANQLLQGKATQISHVTIESLADKLRTITQEATVIDVTPEPLLDDTKG* |
⦗Top⦘ |