| Basic Information | |
|---|---|
| Taxon OID | 3300009175 Open in IMG/M |
| Scaffold ID | Ga0073936_10001914 Open in IMG/M |
| Source Dataset Name | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 31638 |
| Total Scaffold Genes | 27 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (37.04%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Lake Alinen Mustajarvi | |||||||
| Coordinates | Lat. (o) | 61.5637 | Long. (o) | 22.044 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020915 | Metagenome / Metatranscriptome | 221 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073936_100019148 | F020915 | N/A | MKIGLEKPMASVIEIPESLAQELDQLAQSEHKARAAYVVDLLWRDVKRTKLRQALDNSSGAWDLANHPELAEGGAAYVDRIRSEPDERFEEAVRRNQIP* |
| ⦗Top⦘ |