Scaffold Ga0114996_10761490

Overview

Basic Information

• Taxon OID: 3300009173
• Scaffold ID: Ga0114996_10761490
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 704
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Zunongwangia → Zunongwangia profunda (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 75.2588
  • Long. (^o): -156.0227
  • Depth (m): 208

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011767	Metagenome / Metatranscriptome	287	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114996_107614902	F011767	AGG	MEAIIKKIGIWHSKLFSKLSEKAKNSKFWAILLTLAILYEIVEHVVYPILVPWLLYLNFWAD*