Scaffold Ga0114995_10338444

Overview

Basic Information

• Taxon OID: 3300009172
• Scaffold ID: Ga0114995_10338444
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 827
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 73.2247
  • Long. (^o): -150.2247
  • Depth (m): 7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097510	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114995_103384445	F097510	GAG	VIKPFRIVWELIEFGLQALFVYVLVIIIFIGVLFTIIHKEKNKEQVWNDAIEEAKIEYKKECTRIDGCRIRKDGTV