Basic Information | |
---|---|
Taxon OID | 3300009172 Open in IMG/M |
Scaffold ID | Ga0114995_10003977 Open in IMG/M |
Source Dataset Name | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 9907 |
Total Scaffold Genes | 17 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (82.35%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic Ocean: Canada Basin | |||||||
Coordinates | Lat. (o) | 73.2247 | Long. (o) | -150.2247 | Alt. (m) | Depth (m) | 7 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003880 | Metagenome | 464 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114995_100039775 | F003880 | GGAGG | MAKKTKEINKILNLTEQQAKQILEMLESLRSINAQTDDKCPIDYDMVCKLDGMEHQLANIVDATVECKHGHYSRWSGSYEYK* |
⦗Top⦘ |