Scaffold Ga0114968_10006624

Overview

Basic Information

• Taxon OID: 3300009155
• Scaffold ID: Ga0114968_10006624
• Source Dataset Name: Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8528
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Montjoie, Canada
• Coordinates
  • Lat. (^o): 45.4091
  • Long. (^o): -72.0994
  • Depth (m): 3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056310	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114968_100066242	F056310	GAGG	MTIYIPLLYICIALECKFFQSEIYTLDKQKCEQEIAQQKIEITKQGNTVEVVCVDMEIKLEEKSRKPDLYNTVYQTLNNK*