| Basic Information | |
|---|---|
| Taxon OID | 3300009154 Open in IMG/M |
| Scaffold ID | Ga0114963_10141234 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1437 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Croche, Canada | |||||||
| Coordinates | Lat. (o) | 46.8319 | Long. (o) | -72.5 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018911 | Metagenome / Metatranscriptome | 232 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114963_101412342 | F018911 | AGAAG | MEMIDYVTTFFAIFLLDIVYTYYLRCVADNNVLGASFWSIACYIFGSVAVINYTTNHWLLIPAMAGAFCGTYIGMKIRKKSVTS* |
| ⦗Top⦘ |