Scaffold Ga0114963_10075409

Overview

Basic Information

• Taxon OID: 3300009154
• Scaffold ID: Ga0114963_10075409
• Source Dataset Name: Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2100
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Croche, Canada
• Coordinates
  • Lat. (^o): 46.8319
  • Long. (^o): -72.5
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030692	Metagenome	184	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114963_100754091	F030692	GGAG	MAETEDKKGIVIKFNPVEYEAIREIGDGNLSEGFRVCLRWAVHFHAIGLRSDDDLDYIGLCTVAD*