| Basic Information | |
|---|---|
| Taxon OID | 3300009151 Open in IMG/M |
| Scaffold ID | Ga0114962_10000639 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 30670 |
| Total Scaffold Genes | 31 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (6.45%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Croche, Canada | |||||||
| Coordinates | Lat. (o) | 46.8319 | Long. (o) | -72.5 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028176 | Metagenome / Metatranscriptome | 192 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114962_1000063911 | F028176 | N/A | MSNKITTLGYILKRLRDSGYYAHKLYTDFSEVDPRSWMLVIDPTHSSIICTCYVNDPYLGESYLELYDGGQFIPGRLKLKTSSYEILVETLVKFGINNKTDKYNNREEPLNKNERR* |
| ⦗Top⦘ |