NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105243_10001869

Scaffold Ga0105243_10001869


Overview

Basic Information
Taxon OID3300009148 Open in IMG/M
Scaffold IDGa0105243_10001869 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17972
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026603Metagenome197Y
F093466Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0105243_1000186910F026603GAGGMRTVRTPLALPFLVILVITAPQCIRAQTPAGPTLLTEQNSQRAIALDSVTRIRDPLPVVALYNFQQGRDPRTRVALFGINLDLMPGENASAVTAQARDSRSRNYSLKVEFVGKVPTLDWLTQVVVRLPDELAQAGDVWISVNLHGQTSNEVLFSVKVQSEPRTVTLAARRTINGVDNYVNACFSFEFGMNGADALSLTRNDWDVQFGNDPNRDAFSVTMVTDDRSRIQDMGALNWSDAFQVPVIPAYPVPTNEPQVNAVVGHMYVVHTADTSTDLYFLFRVEALEPKKSASISWKAVQRPLGD*
Ga0105243_1000186911F093466AGGAMPKVFRHDAITLQSGVSDEDFEKFMKKELIPYFSEAYRGPTRASRADLKSQSLLRDAKGRRKWLWVTAWDGSPESVRGSSFEHTRMNRIEATEAMLKKLASFGKRTTEKVFSELHSAKVGTNK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.