Basic Information | |
---|---|
Taxon OID | 3300009139 Open in IMG/M |
Scaffold ID | Ga0114949_10372541 Open in IMG/M |
Source Dataset Name | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1140 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kermadec Trench | |||||||
Coordinates | Lat. (o) | -34.3456 | Long. (o) | -178.1771 | Alt. (m) | Depth (m) | 8081 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074900 | Metagenome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114949_103725411 | F074900 | AGGAG | MAAKIVDLADPDESATLCATVEEAKETLAAMVERYESQGYRIAEQHLPDADYPQYAVYVLGFSWIGT* |
⦗Top⦘ |