Scaffold Ga0114949_10059647

Overview

Basic Information

• Taxon OID: 3300009139
• Scaffold ID: Ga0114949_10059647
• Source Dataset Name: Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2866
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Kermadec Trench
• Coordinates
  • Lat. (^o): -34.3456
  • Long. (^o): -178.1771
  • Depth (m): 8081

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101197	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114949_100596471	F101197	GAG	MVRIRLFRRIAGTVVLIGLPTLASCEAVDLRAKVLSVLEAMQRPFDLQDLTFLGIPAAVLAHVIVSAVLAGALVWFWRPKAVGVLLGILILGKEAVDLMIIALYEPVTWARASNSVVDVLASVAGVYLGFWVCA