Scaffold Ga0118729_1103388

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118729_1103388

Scaffold Ga0118729_1103388

Overview

Basic Information
Taxon OID	3300009130 Open in IMG/M
Scaffold ID	Ga0118729_1103388 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0139511, Gp0139512
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Genomics Facility
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1380
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location Name	Cariaco Basin, Venezuela
Coordinates	Lat. (^o)	10.5	Long. (^o)	-64.66	Alt. (m)		Depth (m)	103
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080045	Metagenome / Metatranscriptome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0118729_11033881	F080045	AGG	MAQKLPKNPNITRRVREGIKGGVAVTQIFKSCLNMANAPQSYTTFYKIYRDDMDEVKFDIDREVGKTVINQAMSGDFKSQELYLRSRAGWSPSSHVQEQEVGTEEEENESAISALMSALGKDAEDE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.