Scaffold Ga0118728_1046021

Overview

Basic Information

• Taxon OID: 3300009129
• Scaffold ID: Ga0118728_1046021
• Source Dataset Name: Combined Assembly of Gp0139513, Gp0139514
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Genomics Facility
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2313
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location

• Location Name: Cariaco Basin, Venezuela
• Coordinates
  • Lat. (^o): 10.5
  • Long. (^o): -64.66
  • Depth (m): 198

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060430	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118728_10460211	F060430	N/A	DDEMIACIITAIVFSMPTLYYRLKLKAAERIIKKHIETRWMWEEWGE*