| Basic Information | |
|---|---|
| Taxon OID | 3300009127 Open in IMG/M |
| Scaffold ID | Ga0118724_1007963 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0137036, Gp0137038 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Genomics Facility |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 12872 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cariaco Basin, Venezuela | |||||||
| Coordinates | Lat. (o) | 10.5 | Long. (o) | -64.66 | Alt. (m) | Depth (m) | 900 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092080 | Metagenome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0118724_100796312 | F092080 | N/A | MPWKGGKKMQDKRVTIRVPFEIWKALRELQTVGKISSIQQAAVTGMDRLIVSLQNDAKDKKREAAKKRVLDVLVKGKPLGNWEDIHSERTAADVGRS* |
| ⦗Top⦘ |