| Basic Information | |
|---|---|
| Taxon OID | 3300009126 Open in IMG/M |
| Scaffold ID | Ga0118723_1013840 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0139357, Gp0139356 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Genomics Facility |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6556 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cariaco Basin, Venezuela | |||||||
| Coordinates | Lat. (o) | 10.5 | Long. (o) | -64.66 | Alt. (m) | Depth (m) | 198 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026715 | Metagenome / Metatranscriptome | 197 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0118723_10138402 | F026715 | N/A | MRLNSLFGTIFGRRTGVGLKFMSAGVELDGKTKRSRANANAGYSFDVSDAYTGSHYTAGQKDVNLSPETTIELEQRNRNSFYSLNTYTVRGVTTISNGYAYAGPRLKTLSDFAFSSFAANNAITLEGGVGEGEILLENESGVLQHPQSDSWGTTVADWNNLRFTGTLNTSVDGETIRLSDINGTTSNQNHKTNFAFPTEVTKSA* |
| ⦗Top⦘ |