Basic Information | |
---|---|
Taxon OID | 3300009124 Open in IMG/M |
Scaffold ID | Ga0118687_10322851 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 585 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hudson Canyon, US Atlantic Margin | |||||||
Coordinates | Lat. (o) | 39.54345 | Long. (o) | -72.3998 | Alt. (m) | Depth (m) | 541.1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F089993 | Metagenome / Metatranscriptome | 108 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0118687_103228511 | F089993 | N/A | MININQKFINFPERQLGLLFILFSLMIILMLRQFWWQSLEREIKFLEKKISSNQSELNNLLPERFSKDLIQYEPSPESPAKSLQLLQESIKNFEIQILQQNLNSINDSKNNGGFEIILSLKATYQNLTKWLERLESQKNILHITRINVKNLDTSEVSPKIQLDLTVNGFQIPEK* |
⦗Top⦘ |