NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118687_10219743

Scaffold Ga0118687_10219743


Overview

Basic Information
Taxon OID3300009124 Open in IMG/M
Scaffold IDGa0118687_10219743 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)697
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location
Location NameHudson Canyon, US Atlantic Margin
CoordinatesLat. (o)39.54345Long. (o)-72.3998Alt. (m)Depth (m)541.1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002430Metagenome / Metatranscriptome560Y
F006094Metagenome / Metatranscriptome382Y

Sequences

Protein IDFamilyRBSSequence
Ga0118687_102197431F002430AGGAGMMTLKLPKKQVNAVLVALDAEIENQLGGRPVDWESFPEVAAMLMAYYTTRCNFEEENEDAVA*
Ga0118687_102197432F006094AGGAGMLLHEFYSDDDCSRGDTSYRKSCVFKEPDGSYTIVLIQDGAIVEELNLLGHSQQYAENTAEDWVIGARR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.