NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118687_10003672

Scaffold Ga0118687_10003672


Overview

Basic Information
Taxon OID3300009124 Open in IMG/M
Scaffold IDGa0118687_10003672 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5375
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location
Location NameHudson Canyon, US Atlantic Margin
CoordinatesLat. (o)39.54345Long. (o)-72.3998Alt. (m)Depth (m)541.1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002444Metagenome / Metatranscriptome558Y
F003693Metagenome / Metatranscriptome473Y
F018479Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0118687_100036722F003693AGGMIKSKLALIDVSADASNSLGVSTEGMLLCGIQFPAAMTGSAITFDFALDNSTWVDVKETDGTDTSYTVSVGDILRVDPSGWAFASNGYIRVTSDGTEAADRSIVLHFRHS*
Ga0118687_100036723F018479AGGAGMANIGNLVDRTYREYLEPMDDIVSYTTLTGAINDTATSVAYNGDLLSVEEEDALDAGAIIEIGQELMICTDLNAVANTITVTRGARGTTAASHSIGDLIKIAPPFPRINVFDAVCDQIKNLYPTLFAVETKSITSKVGYIPLDGSTDNHLVAPIKAISQYTDFSAGSDETGTVFQGVATELVDLPNPFTYTDADGVEQTITYSNNGPDKVNAIQVYNVNAGHTVFVTFKKKFVTPTAESDTLATVGLEDEYEPIIMAGVAAQMIAGRDIPTATADYITDQMGTSNFPVNSASSIRNSLLQYQRALIQQARKDLRARYPEPVTVNKIAYT*
Ga0118687_100036726F002444N/AMGMLLILKEGGSLLIDTIGNLPIDEDIDLLPDAGGSLSLAFREIMEAISVTNSTSSQARAIVMGV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.