Scaffold Ga0118671_1004086

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118671_1004086

Scaffold Ga0118671_1004086

Overview

Basic Information
Taxon OID	3300009121 Open in IMG/M
Scaffold ID	Ga0118671_1004086 Open in IMG/M
Source Dataset Name	Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.A IDBA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6700
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (53.85%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge → Syntrophic Microbial Communities From Biogas Reactors In Seattle, Wa

Source Dataset Sampling Location
Location Name	Seattle, WA
Coordinates	Lat. (^o)	47.652555	Long. (^o)	-122.304991	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073228	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0118671_10040868	F073228	GGA	VEGIDMAITIGDIMDVNNSKYGEFLYKIVMVYPHNMEVDKTELARLIKINNNTLTFERKTGEKFTLDERDIEHMDLFRSPNYKGGE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.