| Basic Information | |
|---|---|
| Taxon OID | 3300009120 Open in IMG/M |
| Scaffold ID | Ga0117941_1010139 Open in IMG/M |
| Source Dataset Name | Lake sediment microbial communities from Tanners Lake, St. Paul, MN |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Minnesota - Twin Cities |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2551 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tanners Lake, St. Paul, MN | |||||||
| Coordinates | Lat. (o) | 44.953471 | Long. (o) | -92.97875 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038305 | Metagenome | 166 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0117941_10101393 | F038305 | AGGAG | MAGWGDDPTLAELRTLVYEEGWTPVSVVEATGAVDTVTVEKDGEQRVFSSDHIAFHRFVEGVKEDFGL* |
| ⦗Top⦘ |