Scaffold Ga0117941_1004927

Overview

Basic Information

• Taxon OID: 3300009120
• Scaffold ID: Ga0117941_1004927
• Source Dataset Name: Lake sediment microbial communities from Tanners Lake, St. Paul, MN
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota - Twin Cities
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3922
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities

Source Dataset Sampling Location

• Location Name: Tanners Lake, St. Paul, MN
• Coordinates
  • Lat. (^o): 44.953471
  • Long. (^o): -92.97875

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079672	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117941_10049275	F079672	N/A	MPRIIREKYENGVLIERTIEGSNVTPWHWLMLVVHTVIAFCLVLFVVISVHDSLSLRAALSEEDASPASCERPGLRS*