Basic Information | |
---|---|
Taxon OID | 3300009112 Open in IMG/M |
Scaffold ID | Ga0115923_11113241 Open in IMG/M |
Source Dataset Name | Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1412 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash → Microbial Communities In Swimming Pool Backwashes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.28967 | Long. (o) | 103.85007 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056088 | Metagenome / Metatranscriptome | 138 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115923_111132413 | F056088 | AGGA | VKLNEDAVFKWVVIIGAAAATVIALTLLTNQLVGALWGLVLVIVGSVYLYRWLARKWPEWRR* |
⦗Top⦘ |