Scaffold Ga0115923_10716215

Overview

Basic Information

• Taxon OID: 3300009112
• Scaffold ID: Ga0115923_10716215
• Source Dataset Name: Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2172
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash → Microbial Communities In Swimming Pool Backwashes

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.28967
  • Long. (^o): 103.85007

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026607	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115923_107162152	F026607	AGGAGG	MMKKFVSTTVALAVALSASVALAGTYVTGALPSEFGAGFIPPNPGILKNVQKASKEGAKLAASVEKCYSKGAANYSKGKATGVSTCLSDPSKGVIPKYVAKVNGIAAKAPGLPDCHNYASDGGIIAGLVKGCNGLTYCQSPSGAFVDGTANL*