| Basic Information | |
|---|---|
| Taxon OID | 3300009112 Open in IMG/M |
| Scaffold ID | Ga0115923_10084310 Open in IMG/M |
| Source Dataset Name | Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1443 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash → Microbial Communities In Swimming Pool Backwashes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.28967 | Long. (o) | 103.85007 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001974 | Metagenome / Metatranscriptome | 609 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115923_100843103 | F001974 | N/A | MAAETGSEGPLRHASVDRLACLVRHWTWADEALARFEQALAGGWRYGEDLIADHPFGAYYHWCALLCGFCDAALEQGLLSTVRLVAIHHDLEVSLPELRACRQLLVVIPESFEEQPRVVDLVHDEEKLGRLRRLHGLFGDVLREERMLREIDSLDQ* |
| ⦗Top⦘ |