Scaffold Ga0115026_10296494

Overview

Basic Information

• Taxon OID: 3300009111
• Scaffold ID: Ga0115026_10296494
• Source Dataset Name: Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1130
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → MCG-6 → miscellaneous Crenarchaeota group-6 archaeon AD8-1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location

• Location Name: Old Woman Creek National Estuarine Research Reserve, Ohio, USA
• Coordinates
  • Lat. (^o): 41.2239
  • Long. (^o): -82.3039
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011857	Metagenome / Metatranscriptome	286	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115026_102964943	F011857	N/A	MEKKDMIKLKIAGTNCYNCKFVSDKEKPVSPRELNNEGGIDPKDKDEMERAKKADLITLPGGLKTDSVNKKFCYHEKVVMYVTARMCCAYWDNEDVKRPWK*