Scaffold Ga0117902_1067529

Overview

Basic Information

• Taxon OID: 3300009104
• Scaffold ID: Ga0117902_1067529
• Source Dataset Name: Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Genomics Facility
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 4139
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location

• Location Name: Cariaco Basin, Venezuela
• Coordinates
  • Lat. (^o): 10.5
  • Long. (^o): -64.66
  • Depth (m): 143

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061815	Metagenome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117902_10675291	F061815	AGGAGG	MNAEKILETYNSGLFLQLEGSFGRHFVSSYLDSGIIKTIDEPGNTIVDGYGREIQLKKAEIDHDRIDELWEENPEFIEEVLEEI*