Basic Information | |
---|---|
Taxon OID | 3300009103 Open in IMG/M |
Scaffold ID | Ga0117901_1031089 Open in IMG/M |
Source Dataset Name | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Georgia Genomics Facility |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3835 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Cariaco Basin, Venezuela | |||||||
Coordinates | Lat. (o) | 10.5 | Long. (o) | -64.66 | Alt. (m) | Depth (m) | 143 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025149 | Metagenome / Metatranscriptome | 203 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117901_10310894 | F025149 | GGAG | MVAKKKKPAEKQTFLRPEDKLELLEALNKAKSVCDDTLECGSAWCHDVHDANNKIREIARKLGYKQENWYCQFTM* |
⦗Top⦘ |