| Basic Information | |
|---|---|
| Taxon OID | 3300009102 Open in IMG/M |
| Scaffold ID | Ga0114948_10205073 Open in IMG/M |
| Source Dataset Name | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1412 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mariana Trench | |||||||
| Coordinates | Lat. (o) | 12.4764 | Long. (o) | 144.8648 | Alt. (m) | Depth (m) | 7939 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084258 | Metagenome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114948_102050732 | F084258 | AGGA | MRSETELKNLIQKAQRADELLNDPLIQEFIISVRGDLLNKFESTSLNDEAERMSAWNQSQVFNAFVTKFTKTIKEGRNAKLTLMDRAGAQIKRII* |
| ⦗Top⦘ |