Scaffold Ga0075418_11087215

Overview

Basic Information

• Taxon OID: 3300009100
• Scaffold ID: Ga0075418_11087215
• Source Dataset Name: Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 866
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location

• Location Name: USA: Tennessee
• Coordinates
  • Lat. (^o): 35.8443
  • Long. (^o): -83.9607
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084609	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075418_110872152	F084609	AGG	MTVSSPNVIEIKVDRLIDDMRFLRSQMIAFDRRLNGFEAYLKPSEPSEQQPESK