NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105240_10189943

Scaffold Ga0105240_10189943


Overview

Basic Information
Taxon OID3300009093 Open in IMG/M
Scaffold IDGa0105240_10189943 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2416
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001528Metagenome / Metatranscriptome677Y
F002396Metagenome / Metatranscriptome564Y
F003157Metagenome / Metatranscriptome504Y
F004392Metagenome / Metatranscriptome440N

Sequences

Protein IDFamilyRBSSequence
Ga0105240_101899432F003157AGGAGGMFDPDANQKQENTDLLGFARFGGLDRLDWLMILISVLLGTIAKQHHVLDLPDWFLEWVSPFLLMAFGYNARRKITEVVESRRDRGKDTREE*
Ga0105240_101899433F002396GAGGMRSLFPSTYDRADVLMSAGCSTFVSAALILVIPRVGIILLEILLGLFFIGCALAARARLRIQARSQVKEGPEGSTNAKAKWFDRYDVLMILIVIAIYSSVSRLLRGAGLSDGTVGILPLILFAAGILLKPRAVQFVERRRKDPTAKTHDGRSRVHADEKQEIARKETVERCQ*
Ga0105240_101899434F004392AGGAMPVNGPETIADLKTSQPVASEGRSVRATRDAKPAVGRGAATRRRRDRQESSQTSGEERFFLASANRNGDVPTLGRECATEAEAIIEAFREKVNLYKVTEFQTRADIGRSGEPVLRKETLKKNNPAS*
Ga0105240_101899435F001528AGGAGMSEKNQIVVVLIVALVLGALIDRSTALKIVAGVVLLWTLQNQPVVFECIRKLFSFVQRRPSVREYRGGVTTVRAS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.