| Basic Information | |
|---|---|
| Taxon OID | 3300009073 Open in IMG/M |
| Scaffold ID | Ga0114957_1262000 Open in IMG/M |
| Source Dataset Name | Marine algal microbial communities from Bantry Bay, Ireland - BantryBay_4 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 500 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bantry Bay, Ireland | |||||||
| Coordinates | Lat. (o) | 51.64 | Long. (o) | -9.71 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058639 | Metagenome | 134 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114957_12620001 | F058639 | N/A | PRKSVDTTCLQKPKTRLASILAAARPRRLHVEQLAPCQHIAVSVANRAITVYWAVTAVPRKSVDTTCLQKPKTRLASILSASRPRRLHVEQLAPCQHIAVSVANRAATVYWAVTAVPRKSVDTTCVQKPKTRLARVLAAARPRRLHVEQLAPCQHIAVSVANRATT |
| ⦗Top⦘ |